| Edit |   |
|---|
| Antigenic Specificity | FAM118A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, guinea pig, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-FAM118A Antibody |
|---|
| Immunogen | The immunogen for Anti-FAM118A Antibody: synthetic peptide directed towards the middle region of human FAM118A. Synthetic peptide located within the following region: EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL |
|---|
| Other Names | C22orf8, family with sequence similarity 118, member A |
|---|
| Gene, Accession # | F118A, Accession: NM_001104595 |
|---|
| Catalog # | TA335911 |
|---|
| Price | |
|---|
| Order / More Info | FAM118A Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|