| Edit |   |
| Antigenic Specificity | ATP5SL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rabbit, guinea pig |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ATP5SL Antibody |
| Immunogen | The immunogen for Anti-ATP5SL antibody is: synthetic peptide directed towards the C-terminal region of Human ATP5SL. Synthetic peptide located within the following region: ISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPV |
| Other Names | ATP5S-like |
| Gene, Accession # | AT5SL, Accession: NM_018035 |
| Catalog # | TA330665 |
| Price | |
| Order / More Info | ATP5SL Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |