| Edit |   |
|---|
| Antigenic Specificity | Fam172a |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-Fam172a Antibody |
|---|
| Immunogen | The immunogen for anti-Fam172a antibody: synthetic peptide directed towards the n terminal of mouse 1110033M05Rik. Synthetic peptide located within the following region: NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSDLLSRID |
|---|
| Other Names | C5orf21, family with sequence similarity 172, member A |
|---|
| Gene, Accession # | Fam172a, Accession: NM_001163419 |
|---|
| Catalog # | TA331448 |
|---|
| Price | |
|---|
| Order / More Info | Fam172a Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|