| Edit |   |
|---|
| Antigenic Specificity | TFAP2B - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, horse, mouse, rabbit, rat, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TFAP2B Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-TFAP2B antibody: synthetic peptide directed towards the N terminal of human TFAP2B. Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP |
|---|
| Other Names | AP2B, AP2B, transcription factor AP-2 beta (activating enhancer binding protein 2 beta) |
|---|
| Gene, Accession # | AP2B, Accession: NM_003221 |
|---|
| Catalog # | TA344548 |
|---|
| Price | |
|---|
| Order / More Info | TFAP2B - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|