| Edit |   |
|---|
| Antigenic Specificity | TFAP2D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-TFAP2D antibody |
|---|
| Immunogen | The immunogen for anti-TFAP2D antibody: synthetic peptide directed towards the C terminal of human TFAP2D. Synthetic peptide located within the following region: LGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNY |
|---|
| Other Names | TFAP2BL1, transcription factor AP-2 delta (activating enhancer binding protein 2 delta) |
|---|
| Gene, Accession # | AP2D, Accession: NM_172238 |
|---|
| Catalog # | TA329107 |
|---|
| Price | |
|---|
| Order / More Info | TFAP2D Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|