| Edit |   |
| Antigenic Specificity | GRIPAP1 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-GRIPAP1 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-GRIPAP1 antibody: synthetic peptide directed towards the N terminal of human GRIPAP1. Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV |
| Other Names | GRASP1, GRIP1 associated protein 1 |
| Gene, Accession # | GRAP1, Accession: NM_020137 |
| Catalog # | TA344807 |
| Price | |
| Order / More Info | GRIPAP1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |