| Edit |   |
| Antigenic Specificity | FBXW12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-FBXW12 Antibody |
| Immunogen | The immunogen for Anti-FBXW12 Antibody is: synthetic peptide directed towards the C-terminal region of Human FBXW12. Synthetic peptide located within the following region: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA |
| Other Names | FBW12, FBXO12, FBXO35, F-box and WD repeat domain containing 12 |
| Gene, Accession # | FBW12, Accession: NM_001159929 |
| Catalog # | TA332170 |
| Price | |
| Order / More Info | FBXW12 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |