| Edit |   |
|---|
| Antigenic Specificity | FBXW4 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-FBXW4 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-FBXW4 antibody is: synthetic peptide directed towards the N-terminal region of Human FBXW4. Synthetic peptide located within the following region: RQMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCH |
|---|
| Other Names | DAC, FBW4, FBWD4, SHFM3, SHSF3, F-box and WD repeat domain containing 4 |
|---|
| Gene, Accession # | FBXW4, Accession: NM_022039 |
|---|
| Catalog # | TA344711 |
|---|
| Price | |
|---|
| Order / More Info | FBXW4 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|