| Edit |   |
| Antigenic Specificity | Use1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Use1 Antibody |
| Immunogen | The immunogen for anti-Use1 antibody: synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL |
| Other Names | P31, SLT1, unconventional SNARE in the ER 1 homolog (S. cerevisiae) |
| Gene, Accession # | Use1, Accession: NM_025917 |
| Catalog # | TA329932 |
| Price | |
| Order / More Info | Use1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |