| Edit |   |
|---|
| Antigenic Specificity | PBLD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PBLD Antibody |
|---|
| Immunogen | The immunogen for Anti-PBLD Antibody: synthetic peptide directed towards the N terminal of human PBLD. Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR |
|---|
| Other Names | MAWBP, MAWDBP, phenazine biosynthesis-like protein domain containing |
|---|
| Gene, Accession # | PBLD, Accession: NM_001033083 |
|---|
| Catalog # | TA336026 |
|---|
| Price | |
|---|
| Order / More Info | PBLD Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|