| Edit |   |
|---|
| Antigenic Specificity | SLC18A1 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, horse, human, porcine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SLC18A1 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-SLC18A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC18A1. Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM |
|---|
| Other Names | CGAT, VAT1, VMAT1, solute carrier family 18 (vesicular monoamine transporter), member 1 |
|---|
| Gene, Accession # | VMAT1, Accession: NM_001142325 |
|---|
| Catalog # | TA344468 |
|---|
| Price | |
|---|
| Order / More Info | SLC18A1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|