| Edit |   |
| Antigenic Specificity | VAT1L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse; human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-VAT1L Antibody |
| Immunogen | The immunogen for Anti-Vat1l antibody is: synthetic peptide directed towards the N-terminal region of Vat1l. Synthetic peptide located within the following region: FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN |
| Other Names | vesicle amine transport 1-like |
| Gene, Accession # | VAT1L, Accession: NM_020927 |
| Catalog # | TA344752 |
| Price | |
| Order / More Info | VAT1L Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |