| Edit |   |
|---|
| Antigenic Specificity | NPY2R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-NPY2R Antibody |
|---|
| Immunogen | The immunogen for Anti-NPY2R antibody is: synthetic peptide directed towards the N-terminal region of Human NPY2R. Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV |
|---|
| Other Names | NPY2R, neuropeptide Y receptor Y2 |
|---|
| Gene, Accession # | NPY2R, Accession: NM_000910 |
|---|
| Catalog # | TA329176 |
|---|
| Price | |
|---|
| Order / More Info | NPY2R Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|