| Edit |   |
|---|
| Antigenic Specificity | EIF5A2 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, guinea pig, human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-EIF5A2 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-EIF5A2 antibody: synthetic peptide directed towards the N terminal of human EIF5A2. Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK |
|---|
| Other Names | EIF5A2, eIF5AII, eukaryotic translation initiation factor 5A2 |
|---|
| Gene, Accession # | IF5A2, Accession: NM_020390 |
|---|
| Catalog # | TA344786 |
|---|
| Price | |
|---|
| Order / More Info | EIF5A2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|