| Edit |   |
|---|
| Antigenic Specificity | MICA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MICA Antibody |
|---|
| Immunogen | The immunogen for anti-MICA antibody: synthetic peptide directed towards the middle region of human MICA. Synthetic peptide located within the following region: LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT |
|---|
| Other Names | MICA, PERB11.1, MHC class I polypeptide-related sequence A |
|---|
| Gene, Accession # | MICA, Accession: NM_000247 |
|---|
| Catalog # | TA334664 |
|---|
| Price | |
|---|
| Order / More Info | MICA Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|