| Edit |   |
| Antigenic Specificity | SH2D4A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SH2D4A Antibody |
| Immunogen | The immunogen for Anti-SH2D4A antibody is: synthetic peptide directed towards the N-terminal region of Human SH2D4A. Synthetic peptide located within the following region: IWKKVAEKEELEQGSRPAPTLEEEKIRSLSSSSRNIQQMLADSINRMKAY |
| Other Names | PPP1R38, SH2A, SH2 domain containing 4A |
| Gene, Accession # | SH24A, Accession: NM_022071 |
| Catalog # | TA331225 |
| Price | |
| Order / More Info | SH2D4A Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |