| Edit |   |
|---|
| Antigenic Specificity | DOK6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-DOK6 Antibody |
|---|
| Immunogen | The immunogen for anti-DOK6 antibody: synthetic peptide directed towards the middle region of human DOK6. Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI |
|---|
| Other Names | DOK5L, HsT3226, docking protein 6 |
|---|
| Gene, Accession # | DOK6, Accession: NM_152721 |
|---|
| Catalog # | TA329777 |
|---|
| Price | |
|---|
| Order / More Info | DOK6 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|