| Edit |   |
| Antigenic Specificity | GPRIN2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | yeast, human, guinea pig, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-GPRIN2 Antibody |
| Immunogen | The immunogen for anti-GPRIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPRIN2. Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE |
| Other Names | GRIN2, KIAA0514, G protein regulated inducer of neurite outgrowth 2 |
| Gene, Accession # | GRIN2, Accession: NM_014696 |
| Catalog # | TA334307 |
| Price | |
| Order / More Info | GPRIN2 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |