| Edit |   |
|---|
| Antigenic Specificity | TCL1A - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TCL1A Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-TCL1A antibody: synthetic peptide directed towards the N terminal of human TCL1A. Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL |
|---|
| Other Names | TCL1, T-cell leukemia/lymphoma 1A |
|---|
| Gene, Accession # | TCL1A, Accession: NM_021966 |
|---|
| Catalog # | TA344195 |
|---|
| Price | |
|---|
| Order / More Info | TCL1A - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|