| Edit |   |
|---|
| Antigenic Specificity | TCP11L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-TCP11L2 Antibody |
|---|
| Immunogen | The immunogen for anti-TCP11L2 antibody: synthetic peptide directed towards the N terminal of human TCP11L2. Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC |
|---|
| Other Names | t-complex 11, testis-specific-like 2 |
|---|
| Gene, Accession # | T11L2, Accession: NM_152772 |
|---|
| Catalog # | TA329794 |
|---|
| Price | |
|---|
| Order / More Info | TCP11L2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|