| Edit |   |
| Antigenic Specificity | TCP11L1 - C-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-TCP11L1 Antibody - C-terminal region |
| Immunogen | The immunogen for Anti-TCP11L1 antibody is: synthetic peptide directed towards the C-terminal region of Human TCP11L1. Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE |
| Other Names | dJ85M6.3, t-complex 11, testis-specific-like 1 |
| Gene, Accession # | T11L1, Accession: NM_018393 |
| Catalog # | TA344863 |
| Price | |
| Order / More Info | TCP11L1 - C-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |