| Edit |   |
| Antigenic Specificity | RGD1307041 - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RGD1307041 Antibody - middle region |
| Immunogen | The immunogen for anti-RGD1307041 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG |
| Other Names | F10, PCI domain containing 2 |
| Gene, Accession # | PCID2, Accession: NM_018386 |
| Catalog # | TA344864 |
| Price | |
| Order / More Info | RGD1307041 - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |