| Edit |   |
| Antigenic Specificity | RGS10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RGS10 Antibody |
| Immunogen | The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT |
| Other Names | regulator of G-protein signaling 10 |
| Gene, Accession # | RGS10, Accession: NM_001005339 |
| Catalog # | TA330398 |
| Price | |
| Order / More Info | RGS10 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |