| Edit |   |
| Antigenic Specificity | PNMA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PNMA3 Antibody |
| Immunogen | The immunogen for anti-PNMA3 antibody: synthetic peptide directed towards the middle region of human PNMA3. Synthetic peptide located within the following region: RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR |
| Other Names | MA3, MA5, paraneoplastic Ma antigen 3 |
| Gene, Accession # | PNMA3, Accession: NM_013364 |
| Catalog # | TA334482 |
| Price | |
| Order / More Info | PNMA3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |