| Edit |   |
| Antigenic Specificity | SPSB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SPSB3 Antibody |
| Immunogen | The immunogen for Anti-SPSB3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SPSB3. Synthetic peptide located within the following region: PGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRC |
| Other Names | C16orf31, SSB3, splA/ryanodine receptor domain and SOCS box containing 3 |
| Gene, Accession # | SPSB3, Accession: NM_080861 |
| Catalog # | TA331672 |
| Price | |
| Order / More Info | SPSB3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |