| Edit |   |
| Antigenic Specificity | Fkhl18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-Fkhl18 antibody |
| Immunogen | The immunogen for anti-Fkhl18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG |
| Other Names | FKHL18, FREAC10, forkhead box S1 |
| Gene, Accession # | Foxs1, Accession: NM_010226 |
| Catalog # | TA329404 |
| Price | |
| Order / More Info | Fkhl18 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |