| Edit |   |
| Antigenic Specificity | Ccdc85a |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, guinea pig, dog, horse, rat, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Ccdc85a Antibody |
| Immunogen | The immunogen for Anti-Ccdc85a Antibody is: synthetic peptide directed towards the middle region of Rat Ccdc85a. Synthetic peptide located within the following region: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG |
| Other Names | coiled-coil domain containing 85A |
| Gene, Accession # | Ccdc85a, Accession: NM_001191553 |
| Catalog # | TA332155 |
| Price | |
| Order / More Info | Ccdc85a Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |