| Edit |   |
|---|
| Antigenic Specificity | CCDC74A - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CCDC74A Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-CCDC74A antibody: synthetic peptide directed towards the middle region of human CCDC74A. Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL |
|---|
| Other Names | coiled-coil domain containing 74A |
|---|
| Gene, Accession # | CCDC74A, Accession: NM_138770 |
|---|
| Catalog # | TA344341 |
|---|
| Price | |
|---|
| Order / More Info | CCDC74A - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|