| Edit |   |
|---|
| Antigenic Specificity | CCDC85C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, bovine, zebrafish, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CCDC85C Antibody |
|---|
| Immunogen | The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHA |
|---|
| Other Names | coiled-coil domain containing 85C |
|---|
| Gene, Accession # | CCDC85C, Accession: NM_001144995 |
|---|
| Catalog # | TA330858 |
|---|
| Price | |
|---|
| Order / More Info | CCDC85C Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|