| Edit |   |
| Antigenic Specificity | LHPP - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, human, mouse, rabbit, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-LHPP Antibody - middle region |
| Immunogen | The immunogen for anti-LHPP antibody: synthetic peptide directed towards the middle region of human LHPP. Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM |
| Other Names | HDHD2B, phospholysine phosphohistidine inorganic pyrophosphate phosphatase |
| Gene, Accession # | LHPP, Accession: NM_022126 |
| Catalog # | TA344695 |
| Price | |
| Order / More Info | LHPP - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |