| Edit |   |
| Antigenic Specificity | TMPPE |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse, rat, guinea pig, human, bovine |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-TMPPE Antibody |
| Immunogen | The immunogen for Anti-TMPPE Antibody is: synthetic peptide directed towards the N-terminal region of Human TMPPE. Synthetic peptide located within the following region: TVGRTKMEMFVRMVNVLEPDITVIVGDLSDSEASVLRTAVAPLGQLHSHL |
| Other Names | transmembrane protein with metallophosphoesterase domain |
| Gene, Accession # | TMPPE, Accession: NM_001136238 |
| Catalog # | TA335897 |
| Price | |
| Order / More Info | TMPPE Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |