| Edit |   |
| Antigenic Specificity | ACBD6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rabbit, dog, bovine, porcine, horse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ACBD6 Antibody |
| Immunogen | The immunogen for anti-ACBD6 antibody: synthetic peptide directed towards the middle region of human ACBD6. Synthetic peptide located within the following region: EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI |
| Other Names | acyl-CoA binding domain containing 6 |
| Gene, Accession # | ACBD6, Accession: NM_032360 |
| Catalog # | TA342938 |
| Price | |
| Order / More Info | ACBD6 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |