| Edit |   |
|---|
| Antigenic Specificity | KLK10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-KLK10 Antibody |
|---|
| Immunogen | The immunogen for anti-KLK10 antibody: synthetic peptide directed towards the N terminal of human KLK10. Synthetic peptide located within the following region: LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA |
|---|
| Other Names | NES1, PRSSL1, kallikrein-related peptidase 10 |
|---|
| Gene, Accession # | KLK10, Accession: NM_002776 |
|---|
| Catalog # | TA342159 |
|---|
| Price | |
|---|
| Order / More Info | KLK10 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|