| Edit |   |
| Antigenic Specificity | ASPDH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, dog, guinea pig, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ASPDH Antibody |
| Immunogen | The immunogen for Anti-ASPDH Antibody: synthetic peptide directed towards the middle region of human LOC554235. Synthetic peptide located within the following region: LRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSN |
| Other Names | aspartate dehydrogenase domain containing |
| Gene, Accession # | ASPD, Accession: NM_001114598 |
| Catalog # | TA335904 |
| Price | |
| Order / More Info | ASPDH Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |