| Edit |   |
| Antigenic Specificity | BCAP29 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-BCAP29 Antibody |
| Immunogen | The immunogen for Anti-BCAP29 Antibody: synthetic peptide directed towards the middle region of human BCAP29. Synthetic peptide located within the following region: GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT |
| Other Names | BAP29, B-cell receptor-associated protein 29 |
| Gene, Accession # | BAP29, Accession: NM_001008406 |
| Catalog # | TA336145 |
| Price | |
| Order / More Info | BCAP29 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |