| Edit |   |
| Antigenic Specificity | PLA2G2C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PLA2G2C Antibody |
| Immunogen | The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL |
| Other Names | phospholipase A2, group IIC |
| Gene, Accession # | PA2GC, Accession: NM_001105572 |
| Catalog # | TA334348 |
| Price | |
| Order / More Info | PLA2G2C Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |