| Edit |   |
| Antigenic Specificity | TMPRSS11B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rabbit, human, horse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-TMPRSS11B Antibody |
| Immunogen | The immunogen for Anti-TMPRSS11B antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11B. Synthetic peptide located within the following region: DNCENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGS |
| Other Names | transmembrane protease, serine 11B |
| Gene, Accession # | TM11B, Accession: NM_182502 |
| Catalog # | TA330793 |
| Price | |
| Order / More Info | TMPRSS11B Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |