| Edit |   |
|---|
| Antigenic Specificity | C16orf61 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-C16orf61 Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-C16orf61 antibody: synthetic peptide directed towards the middle region of human C16orf61. Synthetic peptide located within the following region: NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE |
|---|
| Other Names | 2310061C15Rik, C16orf61, C-x(9)-C motif containing 2 |
|---|
| Gene, Accession # | CMC2, Accession: NM_020188 |
|---|
| Catalog # | TA344804 |
|---|
| Price | |
|---|
| Order / More Info | C16orf61 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|