Edit |   |
Antigenic Specificity | PKNOX1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PKNOX1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPP |
Other Names | PBX/knotted 1 homeobox 1, PREP1 |
Gene, Accession # | Gene ID: 5316, UniProt: P55347, ENSG00000160199 |
Catalog # | HPA057215 |
Price | |
Order / More Info | PKNOX1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |