| Edit |   |
| Antigenic Specificity | MYLK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MYLK4 Antibody |
| Immunogen | The immunogen for Anti-MYLK4 antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK4. Synthetic peptide located within the following region: EFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDF |
| Other Names | SgK085, myosin light chain kinase family, member 4 |
| Gene, Accession # | MYLK4, Accession: NM_001012418 |
| Catalog # | TA337451 |
| Price | |
| Order / More Info | MYLK4 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |