Edit |   |
Antigenic Specificity | ACKR1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 45%, rat 28%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human ACKR1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS |
Other Names | atypical chemokine receptor 1 (Duffy blood group), CCBP1, CD234, DARC, Dfy, FY, GPD |
Gene, Accession # | Gene ID: 2532, UniProt: Q16570, ENSG00000213088 |
Catalog # | HPA017672 |
Price | |
Order / More Info | ACKR1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |