| Edit |   |
|---|
| Antigenic Specificity | CXorf26 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | guinea pig, horse, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CXorf26 Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-CXorf26 antibody: synthetic peptide directed towards the middle region of human CXorf26. Synthetic peptide located within the following region: KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNK |
|---|
| Other Names | CXorf26, polysaccharide biosynthesis domain containing 1 |
|---|
| Gene, Accession # | CX026, Accession: NM_016500 |
|---|
| Catalog # | TA345013 |
|---|
| Price | |
|---|
| Order / More Info | CXorf26 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|