| Edit |   |
| Antigenic Specificity | CXorf9 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-CXorf9 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-CXorf9 antibody: synthetic peptide directed towards the N terminal of human CXorf9. Synthetic peptide located within the following region: KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM |
| Other Names | 753P9, CXorf9, HACS2, SH3D6C, SLY, SAM and SH3 domain containing 3 |
| Gene, Accession # | SASH3, Accession: NM_018990 |
| Catalog # | TA344829 |
| Price | |
| Order / More Info | CXorf9 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |