Edit |   |
Antigenic Specificity | CPSF4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 98%, rat 53%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human CPSF4 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQ |
Other Names | cleavage and polyadenylation specific factor 4, 30kDa, CPSF30, NAR |
Gene, Accession # | Gene ID: 10898, UniProt: O95639, ENSG00000160917 |
Catalog # | HPA066470 |
Price | |
Order / More Info | CPSF4 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |