| Edit |   |
| Antigenic Specificity | Ribonucleotide Reductase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | C. elegans dog human mouse rat zebrafish |
| Isotype | n/a |
| Format | fluorescein (FITC) conjugate |
| Size | 100ul |
| Concentration | n/a |
| Applications | ELISA WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Recognizes human RRM1. Species crossreactivity: mouse, rat, dog, C. elegans and zebrafish. |
| Immunogen | Synthetic peptide from near the N-terminal region of RRM1 (ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL) |
| Other Names | Ribonucleotide Reductase (Ribonucleoside-Diphosphate Reductase Large Subunit, Ribonucleoside-Diphosphate Reductase Subunit M1, Ribonucleotide Reductase Large Subunit, RRM1, RR1) (FITC) |
| Gene, Accession # | n/a |
| Catalog # | R2031-15B-FITC |
| Price | |
| Order / More Info | Ribonucleotide Reductase Antibody from UNITED STATES BIOLOGICAL |
| Product Specific References | n/a |