Edit |   |
Antigenic Specificity | PLSCR5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 90%, rat 90%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PLSCR5 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VGPCVTCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIHVAADLDVT |
Other Names | phospholipid scramblase family, member 5 |
Gene, Accession # | Gene ID: 389158, UniProt: A0PG75, ENSG00000231213 |
Catalog # | HPA047249 |
Price | |
Order / More Info | PLSCR5 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |