Edit |   |
Antigenic Specificity | LZIC |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 96%, rat 98%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human LZIC polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRK |
Other Names | leucine zipper and CTNNBIP1 domain containing, MGC15436 |
Gene, Accession # | Gene ID: 84328, UniProt: Q8WZA0, ENSG00000162441 |
Catalog # | HPA058614 |
Price | |
Order / More Info | LZIC Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |