| Edit |   |
| Antigenic Specificity | LANCL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, bovine, dog, horse, rabbit, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-LANCL3 Antibody |
| Immunogen | The immunogen for Anti-LANCL3 Antibody: synthetic peptide directed towards the C terminal of human LANCL3. Synthetic peptide located within the following region: ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF |
| Other Names | LanC lantibiotic synthetase component C-like 3 (bacterial) |
| Gene, Accession # | LANC3, Accession: NM_198511 |
| Catalog # | TA333363 |
| Price | |
| Order / More Info | LANCL3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |