Edit |   |
Antigenic Specificity | LYZL6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 77%, rat 77%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human LYZL6 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY |
Other Names | lysozyme-like 6, LYC1, PRO1485, TKAL754 |
Gene, Accession # | Gene ID: 57151, UniProt: O75951, ENSG00000275722 |
Catalog # | HPA053073 |
Price | |
Order / More Info | LYZL6 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |