| Edit |   |
| Antigenic Specificity | GATA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-GATA5 antibody |
| Immunogen | The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the middle region of human GATA5. Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP |
| Other Names | GATAS, bB379O24.1, GATA binding protein 5 |
| Gene, Accession # | GATA5, Accession: NM_080473 |
| Catalog # | TA329360 |
| Price | |
| Order / More Info | GATA5 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |